LRP5L (NM_182492) Human Mass Spec Standard

CAT#: PH311399

LRP5L MS Standard C13 and N15-labeled recombinant protein (NP_872298)

Product Images

Coomassie blue staining of purified LRP5L protein (Cat# TP311399). The protein was produced from HEK293T cells transfected with LRP5L cDNA clone (Cat# RC211399) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211399
• Predicted MW: 28.3 kDa
• Protein Sequence:
  Sequence Link

  >RC211399 representing NM_182492
  Red=Cloning site Green=Tags(s)
  
  MEGHVYWTDDEVWAIRRAYLDGSGAQTLINTKINDPDDIAVNWVARSLYWTHTGTEHIEVTCLNSTSHKI
  LVSEDMDEPRAIALHPEMGLTYWIDWGENPEIKRANLDRQELRVLVNASLGWPNGLALDLQEGKLYWGDA
  KTDKIEAISVDETKRQTLLKDKLPHIFRFTLLGDFIYWTAWQHHSIKRVHKVKANRDVIIDQLPDLMGLK
  AVNVDKVVGTNPHADRNGGAATCASSRPTQPGLAAPSRAWNC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_872298
• RefSeq Size: 3601
• RefSeq ORF: 756
• Synonyms: DKFZp434O0213
• Locus ID: 91355
• UniProt ID: A4QPB2
• Cytogenetics: 22q11.23
• Protein Families: Druggable Genome