LRP5L (NM_182492) Human Recombinant Protein
CAT#: TP311399
Recombinant protein of human low density lipoprotein receptor-related protein 5-like (LRP5L), transcript variant 1
View other "LRP5L" proteins (6)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211399 representing NM_182492
Red=Cloning site Green=Tags(s) MEGHVYWTDDEVWAIRRAYLDGSGAQTLINTKINDPDDIAVNWVARSLYWTHTGTEHIEVTCLNSTSHKI LVSEDMDEPRAIALHPEMGLTYWIDWGENPEIKRANLDRQELRVLVNASLGWPNGLALDLQEGKLYWGDA KTDKIEAISVDETKRQTLLKDKLPHIFRFTLLGDFIYWTAWQHHSIKRVHKVKANRDVIIDQLPDLMGLK AVNVDKVVGTNPHADRNGGAATCASSRPTQPGLAAPSRAWNC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_872298 |
Locus ID | 91355 |
UniProt ID | A4QPB2 |
Cytogenetics | 22q11.23 |
Refseq Size | 3601 |
Refseq ORF | 756 |
Synonyms | DKFZp434O0213 |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405514 | LRP5L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427704 | LRP5L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405514 | Transient overexpression lysate of low density lipoprotein receptor-related protein 5-like (LRP5L), transcript variant 1 |
USD 396.00 |
|
LY427704 | Transient overexpression lysate of low density lipoprotein receptor-related protein 5-like (LRP5L), transcript variant 2 |
USD 396.00 |
|
PH311399 | LRP5L MS Standard C13 and N15-labeled recombinant protein (NP_872298) |
USD 2,055.00 |
|
TP760928 | Purified recombinant protein of Human low density lipoprotein receptor-related protein 5-like (LRP5L), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review