LRP5L (NM_182492) Human Recombinant Protein

CAT#: TP311399

Recombinant protein of human low density lipoprotein receptor-related protein 5-like (LRP5L), transcript variant 1

Product Images

Coomassie blue staining of purified LRP5L protein (Cat# TP311399). The protein was produced from HEK293T cells transfected with LRP5L cDNA clone (Cat# RC211399) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC211399 representing NM_182492
  Red=Cloning site Green=Tags(s)
  
  MEGHVYWTDDEVWAIRRAYLDGSGAQTLINTKINDPDDIAVNWVARSLYWTHTGTEHIEVTCLNSTSHKI
  LVSEDMDEPRAIALHPEMGLTYWIDWGENPEIKRANLDRQELRVLVNASLGWPNGLALDLQEGKLYWGDA
  KTDKIEAISVDETKRQTLLKDKLPHIFRFTLLGDFIYWTAWQHHSIKRVHKVKANRDVIIDQLPDLMGLK
  AVNVDKVVGTNPHADRNGGAATCASSRPTQPGLAAPSRAWNC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_872298
• Locus ID: 91355
• UniProt ID: A4QPB2
• Cytogenetics: 22q11.23
• Refseq Size: 3601
• Refseq ORF: 756
• Synonyms: DKFZp434O0213
• Protein Families: Druggable Genome