PAX2 (NM_003987) Human Mass Spec Standard
CAT#: PH312051
PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_003978)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212051 |
| Predicted MW | 44.5 kDa |
| Protein Sequence |
>RC212051 representing NM_003987
Red=Cloning site Green=Tags(s) MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILG RYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIR TKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEKRKRDEVEVYT DPAHIRGGGGLHLVWTLRDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQAS EHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQ GSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRFSNPALLSSPYYYSAAPRSAPAAAAAAYDRH TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_003978 |
| RefSeq Size | 4276 |
| RefSeq ORF | 1248 |
| Synonyms | FSGS7; PAPRS |
| Locus ID | 5076 |
| UniProt ID | Q02962 |
| Cytogenetics | 10q24.31 |
| Summary | 'PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2014]' |
| Protein Families | Druggable Genome |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400106 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC418300 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC418301 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC418302 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC418303 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC429172 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429174 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400106 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant b |
USD 436.00 |
|
| LY418300 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant a |
USD 665.00 |
|
| LY418301 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant c |
USD 436.00 |
|
| LY418302 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant d |
USD 436.00 |
|
| LY418303 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant e |
USD 665.00 |
|
| LY429172 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant a |
USD 396.00 |
|
| LY429174 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant e |
USD 396.00 |
|
| PH312112 | PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_000269) |
USD 2,055.00 |
|
| PH318386 | PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_003979) |
USD 2,055.00 |
|
| TP312051 | Recombinant protein of human paired box 2 (PAX2), transcript variant a |
USD 788.00 |
|
| TP312112 | Recombinant protein of human paired box 2 (PAX2), transcript variant b |
USD 748.00 |
|
| TP318386 | Recombinant protein of human paired box 2 (PAX2), transcript variant c |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China