PAX2 (NM_000278) Human Mass Spec Standard

CAT#: PH312112

PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_000269)

Product Images

Coomassie blue staining of purified PAX2 protein (Cat# TP312112). The protein was produced from HEK293T cells transfected with PAX2 cDNA clone (Cat# RC212112) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212112
• Predicted MW: 41.9 kDa
• Protein Sequence:
  Sequence Link

  >RC212112 representing NM_000278
  Red=Cloning site Green=Tags(s)
  
  MDMHCKADPFSAMHRHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGR
  YYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIRT
  KVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEKRKRDEDVSEGS
  VPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVK
  SSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAGMVPGSEFSGNPYSH
  PQYTAYNEAWRFSNPALLSSPYYYSAAPRGSAPAAAAAAYDRH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000269
• RefSeq Size: 4207
• RefSeq ORF: 1179
• Synonyms: FSGS7; PAPRS
• Locus ID: 5076
• UniProt ID: Q02962
• Cytogenetics: 10q24.31
• Summary: 'PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2014]'
• Protein Families: Druggable Genome