AKAP7 (NM_004842) Human Mass Spec Standard
CAT#: PH313040
AKAP7 MS Standard C13 and N15-labeled recombinant protein (NP_004833)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213040 |
| Predicted MW | 8.8 kDa |
| Protein Sequence |
>RC213040 representing NM_004842
Red=Cloning site Green=Tags(s) MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAAD QNGNDNENNRK myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_004833 |
| RefSeq Size | 2279 |
| RefSeq ORF | 243 |
| Synonyms | AKAP15; AKAP18 |
| Locus ID | 9465 |
| UniProt ID | O43687, Q2TAJ5, Q6P4D3 |
| Cytogenetics | 6q23.2 |
| Summary | This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Apr 2011] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413981 | AKAP7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC417708 | AKAP7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429496 | AKAP7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY413981 | Transient overexpression lysate of A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant gamma |
USD 436.00 |
|
| LY417708 | Transient overexpression lysate of A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant alpha |
USD 436.00 |
|
| LY429496 | Transient overexpression lysate of A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant gamma |
USD 396.00 |
|
| PH323812 | AKAP7 MS Standard C13 and N15-labeled recombinant protein (NP_619539) |
USD 2,055.00 |
|
| TP313040 | Recombinant protein of human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant alpha |
USD 823.00 |
|
| TP323812 | Recombinant protein of human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant beta |
USD 748.00 |
|
| TP760674 | Purified recombinant protein of Human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant gamma, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China