AKAP7 (NM_138633) Human Mass Spec Standard

CAT#: PH323812

AKAP7 MS Standard C13 and N15-labeled recombinant protein (NP_619539)

Product Images

Coomassie blue staining of purified AKAP7 protein (Cat# TP323812). The protein was produced from HEK293T cells transfected with AKAP7 cDNA clone (Cat# RC223812) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223812
• Predicted MW: 11.3 kDa
• Protein Sequence:
  Sequence Link

  >RC223812 representing NM_138633
  Red=Cloning site Green=Tags(s)
  
  MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLVENAVLKAVQQ
  YLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_619539
• RefSeq Size: 2348
• RefSeq ORF: 312
• Synonyms: AKAP15; AKAP18
• Locus ID: 9465
• UniProt ID: O43687, Q2TAJ5
• Cytogenetics: 6q23.2
• Summary: This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Apr 2011]
• Protein Families: Druggable Genome