AKAP7 (NM_004842) Human Recombinant Protein
CAT#: TP313040
Recombinant protein of human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant alpha
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213040 representing NM_004842
Red=Cloning site Green=Tags(s) MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAAD QNGNDNENNRK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004833 |
Locus ID | 9465 |
UniProt ID | O43687, Q2TAJ5, Q6P4D3 |
Cytogenetics | 6q23.2 |
Refseq Size | 2279 |
Refseq ORF | 243 |
Synonyms | AKAP15; AKAP18 |
Summary | This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Apr 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413981 | AKAP7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC417708 | AKAP7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC429496 | AKAP7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY413981 | Transient overexpression lysate of A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant gamma |
USD 325.00 |
|
LY417708 | Transient overexpression lysate of A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant alpha |
USD 325.00 |
|
LY429496 | Transient overexpression lysate of A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant gamma |
USD 325.00 |
|
PH313040 | AKAP7 MS Standard C13 and N15-labeled recombinant protein (NP_004833) |
USD 2,055.00 |
|
PH323812 | AKAP7 MS Standard C13 and N15-labeled recombinant protein (NP_619539) |
USD 2,055.00 |
|
TP323812 | Recombinant protein of human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant beta |
USD 748.00 |
|
TP760674 | Purified recombinant protein of Human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant gamma, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review