Plunc (BPIFA1) (NM_016583) Human Mass Spec Standard
CAT#: PH313322
PLUNC MS Standard C13 and N15-labeled recombinant protein (NP_057667)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213322 |
Predicted MW | 26.71 kDa |
Protein Sequence |
>RC213322 representing NM_016583
Red=Cloning site Green=Tags(s) MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILEN LPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQ VNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGI LNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057667 |
RefSeq Size | 1049 |
RefSeq ORF | 768 |
Synonyms | bA49G10.5; LUNX; NASG; PLUNC; SPLUNC1; SPURT |
Locus ID | 51297 |
UniProt ID | Q9NP55 |
Cytogenetics | 20q11.21 |
Summary | This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The encoded antimicrobial protein displays antibacterial activity against Gram-negative bacteria. It is thought to be involved in inflammatory responses to irritants in the upper airways and may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer. Multiple transcript variants resulting from alternative splicing in the 3' UTR have been detected, but the full-length nature of only three are known. [provided by RefSeq, Aug 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402569 | BPIFA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC408781 | BPIFA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402569 | Transient overexpression lysate of palate, lung and nasal epithelium associated (PLUNC), transcript variant 1 |
USD 325.00 |
|
LY408781 | Transient overexpression lysate of palate, lung and nasal epithelium associated (PLUNC), transcript variant 2 |
USD 325.00 |
|
PH303060 | PLUNC MS Standard C13 and N15-labeled recombinant protein (NP_570913) |
USD 2,055.00 |
|
TP303060 | Recombinant protein of human palate, lung and nasal epithelium associated (PLUNC), transcript variant 2 |
USD 823.00 |
|
TP313322 | Recombinant protein of human palate, lung and nasal epithelium associated (PLUNC), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review