Plunc (BPIFA1) (NM_130852) Human Recombinant Protein
CAT#: TP303060
Recombinant protein of human palate, lung and nasal epithelium associated (PLUNC), transcript variant 2
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203060 protein sequence
Red=Cloning site Green=Tags(s) MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILEN LPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQ VNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGI LNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.6 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_570913 |
| Locus ID | 51297 |
| UniProt ID | Q9NP55 |
| Cytogenetics | 20q11.21 |
| Refseq Size | 1090 |
| Refseq ORF | 768 |
| Synonyms | bA49G10.5; LUNX; NASG; PLUNC; SPLUNC1; SPURT |
| Summary | This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The encoded antimicrobial protein displays antibacterial activity against Gram-negative bacteria. It is thought to be involved in inflammatory responses to irritants in the upper airways and may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer. Multiple transcript variants resulting from alternative splicing in the 3' UTR have been detected, but the full-length nature of only three are known. [provided by RefSeq, Aug 2014] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402569 | BPIFA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC408781 | BPIFA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY402569 | Transient overexpression lysate of palate, lung and nasal epithelium associated (PLUNC), transcript variant 1 |
USD 436.00 |
|
| LY408781 | Transient overexpression lysate of palate, lung and nasal epithelium associated (PLUNC), transcript variant 2 |
USD 436.00 |
|
| PH303060 | PLUNC MS Standard C13 and N15-labeled recombinant protein (NP_570913) |
USD 2,055.00 |
|
| PH313322 | PLUNC MS Standard C13 and N15-labeled recombinant protein (NP_057667) |
USD 2,055.00 |
|
| TP313322 | Recombinant protein of human palate, lung and nasal epithelium associated (PLUNC), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China