AMACR (NM_014324) Human Mass Spec Standard
CAT#: PH313437
AMACR MS Standard C13 and N15-labeled recombinant protein (NP_055139)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213437 |
Predicted MW | 42.2 kDa |
Protein Sequence |
>RC213437 representing NM_014324
Red=Cloning site Green=Tags(s) MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLC KRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGVLSKIGRSG ENPYAPLNLLADFAGGGLMCALGIIMALFDRTRTDKGQVIDANMVEGTAYLSSFLWKTQKSSLWEAPRGQ NMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAKKTK AEWCQIFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTPAIPSFKRDPFIGEHT EEILEEFGFSREEIYQLNSDKIIESNKVKASLSGP SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055139 |
RefSeq Size | 2534 |
RefSeq ORF | 1385 |
Synonyms | AMACRD; CBAS4; P504S; RACE; RM |
Locus ID | 23600 |
UniProt ID | Q9UHK6 |
Cytogenetics | 5p13.2 |
Summary | This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene. [provided by RefSeq, Mar 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Primary bile acid biosynthesis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402314 | AMACR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC404323 | AMACR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430917 | AMACR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC432989 | AMACR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402314 | Transient overexpression lysate of alpha-methylacyl-CoA racemase (AMACR), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 325.00 |
|
LY404323 | Transient overexpression lysate of alpha-methylacyl-CoA racemase (AMACR), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 325.00 |
|
LY430917 | Transient overexpression lysate of alpha-methylacyl-CoA racemase (AMACR), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 325.00 |
|
LY432989 | Transient overexpression lysate of alpha-methylacyl-CoA racemase (AMACR), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 325.00 |
|
TP313437 | Recombinant protein of human alpha-methylacyl-CoA racemase (AMACR), transcript variant 1 |
USD 748.00 |
|
TP760792 | Purified recombinant protein of Human alpha-methylacyl-CoA racemase (AMACR), nuclear gene encoding mitochondrial protein, transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review