G0 Protein alpha (GNAO1) (NM_138736) Human Mass Spec Standard
CAT#: PH315437
GNAO1 MS Standard C13 and N15-labeled recombinant protein (NP_620073)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215437 |
| Predicted MW | 40.1 kDa |
| Protein Sequence |
>RC215437 protein sequence
Red=Cloning site Green=Tags(s) MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYK PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQEC FNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERK KWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDIFEEKIK KSPLTICFPEYTGPSAFTEAVAYIQAQYESKNKSAHKEIYTHVTCATDTNNIQFVFDAVTDVIIAKNLRG CGLY myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_620073 |
| RefSeq Size | 6061 |
| RefSeq ORF | 1065 |
| Synonyms | EIEE17; G-ALPHA-o; GNAO; HLA-DQB1; NEDIM |
| Locus ID | 2775 |
| UniProt ID | P09471, Q6AWC5, B3KP89, Q8N6I9 |
| Cytogenetics | 16q13 |
| Summary | 'The protein encoded by this gene represents the alpha subunit of the Go heterotrimeric G-protein signal-transducing complex. Defects in this gene are a cause of early-onset epileptic encephalopathy. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015]' |
| Protein Families | Druggable Genome |
| Protein Pathways | Long-term depression, Melanogenesis |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402819 | GNAO1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC408500 | GNAO1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY402819 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1 |
USD 436.00 |
|
| LY408500 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2 |
USD 396.00 |
|
| PH317958 | GNAO1 MS Standard C13 and N15-labeled recombinant protein (NP_066268) |
USD 2,055.00 |
|
| TP315437 | Recombinant protein of human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2 |
USD 748.00 |
|
| TP317958 | Recombinant protein of human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China