G0 Protein alpha (GNAO1) (NM_020988) Human Mass Spec Standard

CAT#: PH317958

GNAO1 MS Standard C13 and N15-labeled recombinant protein (NP_066268)

Product Images

Coomassie blue staining of purified GNAO1 protein (Cat# TP317958). The protein was produced from HEK293T cells transfected with GNAO1 cDNA clone (Cat# RC217958) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217958
• Predicted MW: 40.1 kDa
• Protein Sequence:
  Sequence Link

  >RC217958 representing NM_020988
  Red=Cloning site Green=Tags(s)
  
  MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYK
  PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQEC
  FNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERK
  KWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIK
  KSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRG
  CGLY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_066268
• RefSeq Size: 3332
• RefSeq ORF: 1062
• Synonyms: EIEE17; G-ALPHA-o; GNAO; HLA-DQB1; NEDIM
• Locus ID: 2775
• UniProt ID: P09471, B3KP89, Q8N6I9
• Cytogenetics: 16q13
• Summary: 'The protein encoded by this gene represents the alpha subunit of the Go heterotrimeric G-protein signal-transducing complex. Defects in this gene are a cause of early-onset epileptic encephalopathy. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015]'
• Protein Families: Druggable Genome
• Protein Pathways: Long-term depression, Melanogenesis