KCNJ9 (NM_004983) Human Mass Spec Standard

CAT#: PH316336

KCNJ9 MS Standard C13 and N15-labeled recombinant protein (NP_004974)

Product Images

Coomassie blue staining of purified KCNJ9 protein (Cat# TP316336). The protein was produced from HEK293T cells transfected with KCNJ9 cDNA clone (Cat# RC216336) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216336
• Predicted MW: 43.8 kDa
• Protein Sequence:
  Sequence Link

  >RC216336 representing NM_004983
  Red=Cloning site Green=Tags(s)
  
  MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYAL
  TWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLL
  LQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLI
  RSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMV
  EATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLY
  WSIPSRLDEKVEEEGAGEGAGGEAGADKEQNGCLPPPESESKV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004974
• RefSeq Size: 3029
• RefSeq ORF: 1179
• Synonyms: GIRK3; KIR3.3
• Locus ID: 3765
• UniProt ID: Q92806
• Cytogenetics: 1q23.2
• Summary: 'Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. It associates with another G-protein-activated potassium channel to form a heteromultimeric pore-forming complex. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane