KCNJ9 (NM_004983) Human Mass Spec Standard
CAT#: PH316336
KCNJ9 MS Standard C13 and N15-labeled recombinant protein (NP_004974)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216336 |
Predicted MW | 43.8 kDa |
Protein Sequence |
>RC216336 representing NM_004983
Red=Cloning site Green=Tags(s) MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYAL TWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLL LQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLI RSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMV EATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLY WSIPSRLDEKVEEEGAGEGAGGEAGADKEQNGCLPPPESESKV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004974 |
RefSeq Size | 3029 |
RefSeq ORF | 1179 |
Synonyms | GIRK3; KIR3.3 |
Locus ID | 3765 |
UniProt ID | Q92806 |
Cytogenetics | 1q23.2 |
Summary | 'Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. It associates with another G-protein-activated potassium channel to form a heteromultimeric pore-forming complex. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Ion Channels: Potassium, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417612 | KCNJ9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY417612 | Transient overexpression lysate of potassium inwardly-rectifying channel, subfamily J, member 9 (KCNJ9) |
USD 325.00 |
|
TP316336 | Recombinant protein of human potassium inwardly-rectifying channel, subfamily J, member 9 (KCNJ9) |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review