ELAVL4 (NM_021952) Human Mass Spec Standard

CAT#: PH318612

ELAVL4 MS Standard C13 and N15-labeled recombinant protein (NP_068771)

Product Images

Coomassie blue staining of purified ELAVL4 protein (Cat# TP318612). The protein was produced from HEK293T cells transfected with ELAVL4 cDNA clone (Cat# RC218612) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218612
• Predicted MW: 41.6 kDa
• Protein Sequence:
  Sequence Link

  >RC218612 representing NM_021952
  Red=Cloning site Green=Tags(s)
  
  MVMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIG
  EIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLP
  KTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFA
  NNPSQKSSQALLSQLYQSPNRRYPGPLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACSPRFSPITIDG
  MTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDE
  AAMAIASLNGYRLGDRVLQVSFKTNKAHKS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_068771
• RefSeq Size: 1591
• RefSeq ORF: 1140
• Synonyms: HUD; PNEM
• Locus ID: 1996
• UniProt ID: P26378
• Cytogenetics: 1p33-p32.3
• Summary: ''
• Protein Families: Druggable Genome