ELAVL4 (NM_021952) Human Recombinant Protein

CAT#: TP318612

Recombinant protein of human ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 1

Product Images

Audiograph of electrophoretic mobility shift assay using labeled RNA probes for the 11 and 13DNR DNR alleles, and purified candidate-binding proteins including ELAVL4 (OriGene TP318612). Results confirm the binding for 4E-BP, elF4E, and ELAVL4, seen as band upshift from the unlabeled oligos. Figure cited from Transl Psychiatry, PMID: 27801893

• 

  Coomassie blue staining of purified ELAVL4 protein (Cat# TP318612). The protein was produced from HEK293T cells transfected with ELAVL4 cDNA clone (Cat# RC218612) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC218612 representing NM_021952
  Red=Cloning site Green=Tags(s)
  
  MVMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIG
  EIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLP
  KTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFA
  NNPSQKSSQALLSQLYQSPNRRYPGPLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACSPRFSPITIDG
  MTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDE
  AAMAIASLNGYRLGDRVLQVSFKTNKAHKS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: EMSA reaction (PMID: 27801893)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_068771
• Locus ID: 1996
• UniProt ID: P26378
• Cytogenetics: 1p33-p32.3
• Refseq Size: 1591
• Refseq ORF: 1140
• Synonyms: HUD; PNEM
• Summary: May play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3' UTR (By similarity). Binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome