USF1 (NM_207005) Human Mass Spec Standard
CAT#: PH319106
USF1 MS Standard C13 and N15-labeled recombinant protein (NP_996888)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219106 |
| Predicted MW | 33.5 kDa |
| Protein Sequence |
>RC219106 protein sequence
Red=Cloning site Green=Tags(s) MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQ LDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFPSTAVGDGAGGTTSGSTAAVV TTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRDEKRRAQHNEVERR RRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQ QVEDLKNKNLLLRAQLRHHGLEVVIKNDSN myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_996888 |
| RefSeq Size | 1799 |
| RefSeq ORF | 933 |
| Synonyms | bHLHb11; FCHL; FCHL1; HYPLIP1; MLTF; MLTFI; UEF |
| Locus ID | 7391 |
| UniProt ID | P22415 |
| Cytogenetics | 1q23.3 |
| Summary | 'This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL). Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been defined on chromosome 21. [provided by RefSeq, Feb 2013]' |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404129 | USF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC416182 | USF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY404129 | Transient overexpression lysate of upstream transcription factor 1 (USF1), transcript variant 2 |
USD 436.00 |
|
| LY416182 | Transient overexpression lysate of upstream transcription factor 1 (USF1), transcript variant 1 |
USD 436.00 |
|
| PH304915 | USF1 MS Standard C13 and N15-labeled recombinant protein (NP_009053) |
USD 2,055.00 |
|
| TP304915 | Recombinant protein of human upstream transcription factor 1 (USF1), transcript variant 1 |
USD 823.00 |
|
| TP319106 | Recombinant protein of human upstream transcription factor 1 (USF1), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China