USF1 (NM_007122) Human Recombinant Protein
CAT#: TP304915
Recombinant protein of human upstream transcription factor 1 (USF1), transcript variant 1
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204915 protein sequence
Red=Cloning site Green=Tags(s) MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQ LDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFPSTAVGDGAGGTTSGSTAAVV TTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRDEKRRAQHNEVERR RRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQ QVEDLKNKNLLLRAQLRHHGLEVVIKNDSN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33.4 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_009053 |
| Locus ID | 7391 |
| UniProt ID | P22415, A0A0S2Z4U5 |
| Cytogenetics | 1q23.3 |
| Refseq Size | 1830 |
| Refseq ORF | 930 |
| Synonyms | bHLHb11; FCHL; FCHL1; HYPLIP1; MLTF; MLTFI; UEF |
| Summary | This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL). Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been defined on chromosome 21. [provided by RefSeq, Feb 2013] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404129 | USF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC416182 | USF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY404129 | Transient overexpression lysate of upstream transcription factor 1 (USF1), transcript variant 2 |
USD 436.00 |
|
| LY416182 | Transient overexpression lysate of upstream transcription factor 1 (USF1), transcript variant 1 |
USD 436.00 |
|
| PH304915 | USF1 MS Standard C13 and N15-labeled recombinant protein (NP_009053) |
USD 2,055.00 |
|
| PH319106 | USF1 MS Standard C13 and N15-labeled recombinant protein (NP_996888) |
USD 2,055.00 |
|
| TP319106 | Recombinant protein of human upstream transcription factor 1 (USF1), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China