USF1 (NM_007122) Human Recombinant Protein
CAT#: TP304915
Recombinant protein of human upstream transcription factor 1 (USF1), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204915 protein sequence
Red=Cloning site Green=Tags(s) MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQ LDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFPSTAVGDGAGGTTSGSTAAVV TTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRDEKRRAQHNEVERR RRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQ QVEDLKNKNLLLRAQLRHHGLEVVIKNDSN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009053 |
Locus ID | 7391 |
UniProt ID | P22415, A0A0S2Z4U5 |
Cytogenetics | 1q23.3 |
Refseq Size | 1830 |
Refseq ORF | 930 |
Synonyms | bHLHb11; FCHL; FCHL1; HYPLIP1; MLTF; MLTFI; UEF |
Summary | This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL). Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been defined on chromosome 21. [provided by RefSeq, Feb 2013] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404129 | USF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC416182 | USF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY404129 | Transient overexpression lysate of upstream transcription factor 1 (USF1), transcript variant 2 |
USD 396.00 |
|
LY416182 | Transient overexpression lysate of upstream transcription factor 1 (USF1), transcript variant 1 |
USD 396.00 |
|
PH304915 | USF1 MS Standard C13 and N15-labeled recombinant protein (NP_009053) |
USD 2,055.00 |
|
PH319106 | USF1 MS Standard C13 and N15-labeled recombinant protein (NP_996888) |
USD 2,055.00 |
|
TP319106 | Recombinant protein of human upstream transcription factor 1 (USF1), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review