Glutaredoxin 1 (GLRX) (NM_002064) Human Mass Spec Standard

CAT#: PH319385

GLRX MS Standard C13 and N15-labeled recombinant protein (NP_002055)

Product Images

Coomassie blue staining of purified GLRX protein (Cat# TP319385). The protein was produced from HEK293T cells transfected with GLRX cDNA clone (Cat# RC219385) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219385
• Predicted MW: 11.6 kDa
• Protein Sequence:
  Sequence Link

  >RC219385 representing NM_002064
  Red=Cloning site Green=Tags(s)
  
  MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTV
  PRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002055
• RefSeq Size: 1328
• RefSeq ORF: 318
• Synonyms: GRX; GRX1
• Locus ID: 2745
• UniProt ID: P35754, A0A024RAM2
• Cytogenetics: 5q15
• Summary: 'This gene encodes a member of the glutaredoxin family. The encoded protein is a cytoplasmic enzyme catalyzing the reversible reduction of glutathione-protein mixed disulfides. This enzyme highly contributes to the antioxidant defense system. It is crucial for several signalling pathways by controlling the S-glutathionylation status of signalling mediators. It is involved in beta-amyloid toxicity and Alzheimer's disease. Multiple alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Aug 2011]'
• Protein Families: Druggable Genome