LPCAT1 (NM_024830) Human Mass Spec Standard

CAT#: PH320083

LPCAT1 MS Standard C13 and N15-labeled recombinant protein (NP_079106)

Product Images

Coomassie blue staining of purified LPCAT1 protein (Cat# TP320083). The protein was produced from HEK293T cells transfected with LPCAT1 cDNA clone (Cat# RC220083) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220083
• Predicted MW: 59 kDa
• Protein Sequence:
  Sequence Link

  >RC220083 representing NM_024830
  Red=Cloning site Green=Tags(s)
  
  MRLRGCGPRAAPASSAGASDARLLAPPGRNPFVHELRLSALQKAQVALMTLTLFPVRLLVAAAMMLLAWP
  LALVASLGSAEKEPEQPPALWRKVVDFLLKAIMRTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFD
  AIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGT
  CTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPS
  EEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEK
  DLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDT
  IQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEY
  LYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079106
• RefSeq Size: 3994
• RefSeq ORF: 1602
• Synonyms: AGPAT9; AGPAT10; AYTL2; lpcat; LPCAT-1; lysoPAFAT; PFAAP3
• Locus ID: 79888
• UniProt ID: Q8NF37
• Cytogenetics: 5p15.33
• Summary: This gene encodes a member of the 1-acyl-sn-glycerol-3-phosphate acyltransferase family of proteins. The encoded enzyme plays a role in phospholipid metabolism, specifically in the conversion of lysophosphatidylcholine to phosphatidylcholine in the presence of acyl-CoA. This process is important in the synthesis of lung surfactant and platelet-activating factor (PAF). Elevated expression of this gene may contribute to the progression of oral squamous cell, prostate, breast, and other human cancers. [provided by RefSeq, Sep 2016]
• Protein Families: Transmembrane