LAMP2 (NM_002294) Human Mass Spec Standard
CAT#: PH321216
LAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_002285)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221216 |
Predicted MW | 44.96 kDa |
Protein Sequence |
>RC221216 representing NM_002294
Red=Cloning site Green=Tags(s) MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHG TVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDEL LAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTT TPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIK YLDFVFAVKNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDL RVQPFNVTQGKYSTAQDCSADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002285 |
RefSeq Size | 1868 |
RefSeq ORF | 1230 |
Synonyms | CD107b; LAMP-2; LAMPB; LGP-96; LGP110 |
Locus ID | 3920 |
UniProt ID | P13473 |
Cytogenetics | Xq24 |
Summary | 'The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Lysosome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419414 | LAMP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY419414 | Transient overexpression lysate of lysosomal-associated membrane protein 2 (LAMP2), transcript variant A |
USD 325.00 |
|
PH300456 | LAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_054701) |
USD 2,055.00 |
|
PH325644 | LAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_001116078) |
USD 2,055.00 |
|
TP300456 | Recombinant protein of human lysosomal-associated membrane protein 2 (LAMP2), transcript variant B |
USD 823.00 |
|
TP321216 | Recombinant protein of human lysosomal-associated membrane protein 2 (LAMP2), transcript variant A |
USD 748.00 |
|
TP325644 | Purified recombinant protein of Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant C |
USD 748.00 |
|
TP720402 | Recombinant protein of human lysosomal-associated membrane protein 2 (LAMP2), transcript variant C |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review