LAMP2 (NM_001122606) Human Mass Spec Standard
CAT#: PH325644
LAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_001116078)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225644 |
| Predicted MW | 45.17 kDa |
| Protein Sequence |
>RC225644 representing NM_001122606
Red=Cloning site Green=Tags(s) MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHG TVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDEL LAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTT TPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIK YLDFVFAVKNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDL RVQPFNVTQGKYSTAEECSADSDLNFLIPVAVGVALGFLIIVVFISYMIGRRKSRTGYQSV myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001116078 |
| RefSeq ORF | 1233 |
| Synonyms | CD107b; LAMP-2; LAMPB; LGP-96; LGP110 |
| Locus ID | 3920 |
| UniProt ID | P13473 |
| Cytogenetics | Xq24 |
| Summary | 'The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
| Protein Pathways | Lysosome |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419414 | LAMP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY419414 | Transient overexpression lysate of lysosomal-associated membrane protein 2 (LAMP2), transcript variant A |
USD 436.00 |
|
| PH300456 | LAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_054701) |
USD 2,055.00 |
|
| PH321216 | LAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_002285) |
USD 2,055.00 |
|
| TP300456 | Recombinant protein of human lysosomal-associated membrane protein 2 (LAMP2), transcript variant B |
USD 823.00 |
|
| TP321216 | Recombinant protein of human lysosomal-associated membrane protein 2 (LAMP2), transcript variant A |
USD 748.00 |
|
| TP325644 | Purified recombinant protein of Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant C |
USD 748.00 |
|
| TP720402 | Recombinant protein of human lysosomal-associated membrane protein 2 (LAMP2), transcript variant C |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China