LAMP2 (NM_013995) Human Recombinant Protein
CAT#: TP300456
Recombinant protein of human lysosomal-associated membrane protein 2 (LAMP2), transcript variant B
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200456 protein sequence
Red=Cloning site Green=Tags(s) MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHG TVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDEL LAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTT TPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIK YLDFVFAVKNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDL RVQPFNVTQGKYSTAQECSLDDDTILIPIIVGAGLSGLIIVIVIAYVIGRRKSYAGYQTL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 42 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_054701 |
| Locus ID | 3920 |
| UniProt ID | P13473 |
| Cytogenetics | Xq24 |
| Refseq Size | 4076 |
| Refseq ORF | 1230 |
| Synonyms | CD107b; DND; LAMP-2; LAMPB; LGP-96; LGP110 |
| Summary | The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
| Protein Pathways | Lysosome |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419414 | LAMP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY419414 | Transient overexpression lysate of lysosomal-associated membrane protein 2 (LAMP2), transcript variant A |
USD 436.00 |
|
| PH300456 | LAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_054701) |
USD 2,055.00 |
|
| PH321216 | LAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_002285) |
USD 2,055.00 |
|
| PH325644 | LAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_001116078) |
USD 2,055.00 |
|
| TP321216 | Recombinant protein of human lysosomal-associated membrane protein 2 (LAMP2), transcript variant A |
USD 748.00 |
|
| TP325644 | Purified recombinant protein of Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant C |
USD 748.00 |
|
| TP720402 | Recombinant protein of human lysosomal-associated membrane protein 2 (LAMP2), transcript variant C |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China