Myelin oligodendrocyte glycoprotein (MOG) (NM_206809) Human Mass Spec Standard

CAT#: PH322455

MOG MS Standard C13 and N15-labeled recombinant protein (NP_996532)

Product Images

Coomassie blue staining of purified MOG protein (Cat# TP322455). The protein was produced from HEK293T cells transfected with MOG cDNA clone (Cat# RC222455) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222455
• Predicted MW: 25.1 kDa
• Protein Sequence:
  Sequence Link

  >RC222455 representing NM_206809
  Red=Cloning site Green=Tags(s)
  
  MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYR
  PPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAM
  ELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKIT
  LFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_996532
• RefSeq Size: 2119
• RefSeq ORF: 741
• Synonyms: BTN6; BTNL11; MOGIG2; NRCLP7
• Locus ID: 4340
• UniProt ID: Q16653
• Cytogenetics: 6p22.1
• Summary: 'The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]'
• Protein Families: Transmembrane