Myelin oligodendrocyte glycoprotein (MOG) (NM_206809) Human Recombinant Protein

CAT#: TP322455

Recombinant protein of human myelin oligodendrocyte glycoprotein (MOG), transcript variant alpha1

Product Images

Coomassie blue staining of purified MOG protein (Cat# TP322455). The protein was produced from HEK293T cells transfected with MOG cDNA clone (Cat# RC222455) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC222455 representing NM_206809
  Red=Cloning site Green=Tags(s)
  
  MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYR
  PPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAM
  ELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKIT
  LFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_996532
• Locus ID: 4340
• UniProt ID: Q16653
• Cytogenetics: 6p22.1
• Refseq Size: 2119
• Refseq ORF: 741
• Synonyms: BTN6; BTNL11; MOGIG2; NRCLP7
• Summary: The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane