CTIP1 (BCL11A) (NM_138559) Human Mass Spec Standard

CAT#: PH323575

BCL11A MS Standard C13 and N15-labeled recombinant protein (NP_612569)

Product Images

Coomassie blue staining of purified BCL11A protein (Cat# TP323575). The protein was produced from HEK293T cells transfected with BCL11A cDNA clone (Cat# RC223575) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223575
• Predicted MW: 26.7 kDa
• Protein Sequence:
  Sequence Link

  >RC223575 representing NM_138559
  Red=Cloning site Green=Tags(s)
  
  MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQ
  CNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGICPKQEHIADKLLHWRGLSSP
  RSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPR
  VLHTPPFGVVPRELKMCGSFRMEAREPLSSEKI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_612569
• RefSeq Size: 2358
• RefSeq ORF: 729
• Synonyms: BCL11A-L; BCL11a-M; BCL11A-S; BCL11A-XL; CTIP1; DILOS; EVI9; HBFQTL5; ZNF856
• Locus ID: 53335
• UniProt ID: Q9H165
• Cytogenetics: 2p16.1
• Summary: This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors