PIG3 (TP53I3) (NM_147184) Human Mass Spec Standard
CAT#: PH324067
TP53I3 MS Standard C13 and N15-labeled recombinant protein (NP_671713)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224067 |
Predicted MW | 35.5 kDa |
Protein Sequence |
>RC224067 protein sequence
Red=Cloning site Green=Tags(s) MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVA ELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQA GDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGV NLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNA FTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_671713 |
RefSeq Size | 1643 |
RefSeq ORF | 996 |
Synonyms | PIG3 |
Locus ID | 9540 |
UniProt ID | Q53FA7 |
Cytogenetics | 2p23.3 |
Summary | The protein encoded by this gene is similar to oxidoreductases, which are enzymes involved in cellular responses to oxidative stresses and irradiation. This gene is induced by the tumor suppressor p53 and is thought to be involved in p53-mediated cell death. It contains a p53 consensus binding site in its promoter region and a downstream pentanucleotide microsatellite sequence. P53 has been shown to transcriptionally activate this gene by interacting with the downstream pentanucleotide microsatellite sequence. The microsatellite is polymorphic, with a varying number of pentanucleotide repeats directly correlated with the extent of transcriptional activation by p53. It has been suggested that the microsatellite polymorphism may be associated with differential susceptibility to cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011] |
Protein Families | Druggable Genome |
Protein Pathways | p53 signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407779 | TP53I3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC417682 | TP53I3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429226 | TP53I3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407779 | Transient overexpression lysate of tumor protein p53 inducible protein 3 (TP53I3), transcript variant 2 |
USD 396.00 |
|
LY417682 | Transient overexpression lysate of tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1 |
USD 396.00 |
|
LY429226 | Transient overexpression lysate of tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1 |
USD 396.00 |
|
PH301839 | TP53I3 MS Standard C13 and N15-labeled recombinant protein (NP_004872) |
USD 2,055.00 |
|
TP301839 | Recombinant protein of human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1 |
USD 823.00 |
|
TP324067 | Recombinant protein of human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review