PIG3 (TP53I3) (NM_004881) Human Recombinant Protein
CAT#: TP301839
Recombinant protein of human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1
View other "TP53I3" proteins (9)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201839 protein sequence
Red=Cloning site Green=Tags(s) MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVA ELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQA GDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGV NLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNA FTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004872 |
Locus ID | 9540 |
UniProt ID | Q53FA7 |
Cytogenetics | 2p23.3 |
Refseq Size | 2042 |
Refseq ORF | 996 |
Synonyms | PIG3 |
Summary | The protein encoded by this gene is similar to oxidoreductases, which are enzymes involved in cellular responses to oxidative stresses and irradiation. This gene is induced by the tumor suppressor p53 and is thought to be involved in p53-mediated cell death. It contains a p53 consensus binding site in its promoter region and a downstream pentanucleotide microsatellite sequence. P53 has been shown to transcriptionally activate this gene by interacting with the downstream pentanucleotide microsatellite sequence. The microsatellite is polymorphic, with a varying number of pentanucleotide repeats directly correlated with the extent of transcriptional activation by p53. It has been suggested that the microsatellite polymorphism may be associated with differential susceptibility to cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011] |
Protein Families | Druggable Genome |
Protein Pathways | p53 signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407779 | TP53I3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC417682 | TP53I3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429226 | TP53I3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407779 | Transient overexpression lysate of tumor protein p53 inducible protein 3 (TP53I3), transcript variant 2 |
USD 396.00 |
|
LY417682 | Transient overexpression lysate of tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1 |
USD 396.00 |
|
LY429226 | Transient overexpression lysate of tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1 |
USD 396.00 |
|
PH301839 | TP53I3 MS Standard C13 and N15-labeled recombinant protein (NP_004872) |
USD 2,055.00 |
|
PH324067 | TP53I3 MS Standard C13 and N15-labeled recombinant protein (NP_671713) |
USD 2,055.00 |
|
TP324067 | Recombinant protein of human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review