Mortality Factor 4 like 2 (MORF4L2) (NM_001142420) Human Mass Spec Standard
CAT#: PH326622
MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_001135892)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226622 |
Predicted MW | 32.3 kDa |
Protein Sequence |
>RC226622 protein sequence
Red=Cloning site Green=Tags(s) MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSG SVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLV TRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEI LLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVAS AEYHRKAL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001135892 |
RefSeq Size | 1827 |
RefSeq ORF | 864 |
Synonyms | MORFL2; MRGX |
Locus ID | 9643 |
UniProt ID | Q15014 |
Cytogenetics | Xq22.2 |
Summary | Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the MSIN3A complex which acts to repress transcription by deacetylation of nucleosomal histones. [UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402188 | MORF4L2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428080 | MORF4L2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402188 | Transient overexpression lysate of mortality factor 4 like 2 (MORF4L2), transcript variant 2 |
USD 396.00 |
|
LY428080 | Transient overexpression lysate of mortality factor 4 like 2 (MORF4L2), transcript variant 1 |
USD 396.00 |
|
PH310566 | MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_036418) |
USD 2,055.00 |
|
PH326523 | MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_001135890) |
USD 2,055.00 |
|
PH326563 | MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_001135891) |
USD 2,055.00 |
|
PH326678 | MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_001135893) |
USD 2,055.00 |
|
TP310566 | Recombinant protein of human mortality factor 4 like 2 (MORF4L2), transcript variant 2 |
USD 823.00 |
|
TP326523 | Purified recombinant protein of Homo sapiens mortality factor 4 like 2 (MORF4L2), transcript variant 1 |
USD 748.00 |
|
TP326563 | Purified recombinant protein of Homo sapiens mortality factor 4 like 2 (MORF4L2), transcript variant 3 |
USD 748.00 |
|
TP326622 | Purified recombinant protein of Homo sapiens mortality factor 4 like 2 (MORF4L2), transcript variant 4 |
USD 748.00 |
|
TP326678 | Purified recombinant protein of Homo sapiens mortality factor 4 like 2 (MORF4L2), transcript variant 5 |
USD 748.00 |
|
TP720543 | Recombinant protein of human mortality factor 4 like 2 (MORF4L2), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review