Mortality Factor 4 like 2 (MORF4L2) (NM_012286) Human Recombinant Protein
CAT#: TP310566
Recombinant protein of human mortality factor 4 like 2 (MORF4L2), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210566 protein sequence
Red=Cloning site Green=Tags(s) MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSG SVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLV TRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEI LLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVAS AEYHRKAL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036418 |
Locus ID | 9643 |
UniProt ID | B3KP92, Q15014 |
Cytogenetics | Xq22.2 |
Refseq Size | 1998 |
Refseq ORF | 864 |
Synonyms | MORFL2; MRGX |
Summary | Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the MSIN3A complex which acts to repress transcription by deacetylation of nucleosomal histones.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402188 | MORF4L2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC428080 | MORF4L2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402188 | Transient overexpression lysate of mortality factor 4 like 2 (MORF4L2), transcript variant 2 |
USD 325.00 |
|
LY428080 | Transient overexpression lysate of mortality factor 4 like 2 (MORF4L2), transcript variant 1 |
USD 325.00 |
|
PH310566 | MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_036418) |
USD 2,055.00 |
|
PH326523 | MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_001135890) |
USD 2,055.00 |
|
PH326563 | MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_001135891) |
USD 2,055.00 |
|
PH326622 | MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_001135892) |
USD 2,055.00 |
|
PH326678 | MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_001135893) |
USD 2,055.00 |
|
TP326523 | Purified recombinant protein of Homo sapiens mortality factor 4 like 2 (MORF4L2), transcript variant 1 |
USD 748.00 |
|
TP326563 | Purified recombinant protein of Homo sapiens mortality factor 4 like 2 (MORF4L2), transcript variant 3 |
USD 748.00 |
|
TP326622 | Purified recombinant protein of Homo sapiens mortality factor 4 like 2 (MORF4L2), transcript variant 4 |
USD 748.00 |
|
TP326678 | Purified recombinant protein of Homo sapiens mortality factor 4 like 2 (MORF4L2), transcript variant 5 |
USD 748.00 |
|
TP720543 | Recombinant protein of human mortality factor 4 like 2 (MORF4L2), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review