FGF1 (NM_001144892) Human Mass Spec Standard
CAT#: PH327317
FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138364)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227317 |
| Predicted MW | 17.5 kDa |
| Protein Sequence |
>RC227317 protein sequence
Red=Cloning site Green=Tags(s) MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVY IKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHY GQKAILFLPLPVSSD myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001138364 |
| RefSeq Size | 3682 |
| RefSeq ORF | 465 |
| Synonyms | AFGF; ECGF; ECGF-beta; ECGFA; ECGFB; FGF-1; FGF-alpha; FGFA; GLIO703; HBGF-1; HBGF1 |
| Locus ID | 2246 |
| UniProt ID | P05230 |
| Cytogenetics | 5q31.3 |
| Summary | 'The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Jan 2009]' |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400278 | FGF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428552 | FGF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428587 | FGF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428588 | FGF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400278 | Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 |
USD 436.00 |
|
| LY428552 | Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 4 |
USD 436.00 |
|
| LY428587 | Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 5 |
USD 436.00 |
|
| LY428588 | Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 6 |
USD 436.00 |
|
| PH307434 | FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_000791) |
USD 2,055.00 |
|
| PH327790 | FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138406) |
USD 2,055.00 |
|
| PH327797 | FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138407) |
USD 2,055.00 |
|
| TP307434 | Recombinant protein of human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 |
USD 823.00 |
|
| TP327317 | Purified recombinant protein of Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 4 |
USD 748.00 |
|
| TP327790 | Purified recombinant protein of Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 5 |
USD 748.00 |
|
| TP327797 | Purified recombinant protein of Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 6 |
USD 748.00 |
|
| TP720040 | Recombinant protein of human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 |
USD 330.00 |
|
| TP721185 | Purified recombinant protein of Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 |
USD 330.00 |
|
| TP723104 | Purified recombinant protein of Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1. |
USD 240.00 |
|
| TP750001 | Recombinant protein of human Fibroblast Growth Factor-acidic (FGF1) produced in E. coli |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China