FGF1 (NM_000800) Human Recombinant Protein
CAT#: TP723104
Purified recombinant protein of Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1.
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
|
| Tag | Tag Free |
| Predicted MW | 16 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | Determined by a cell proliferation assay using Balb/c 3T3 cells. The expected ED50 is ≤ 0.5 ng/ml in the presence of 10 µg/ml heparin, corresponding to a specific activity of ≥ 2 x 106 units/mg. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000791 |
| Locus ID | 2246 |
| UniProt ID | P05230 |
| Cytogenetics | 5q31.3 |
| Refseq Size | 4162 |
| Refseq ORF | 465 |
| Synonyms | AFGF; ECGF; ECGF-beta; ECGFA; ECGFB; FGF-1; FGF-alpha; FGFA; GLIO703; HBGF-1; HBGF1 |
| Summary | 'The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Jan 2009]' |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400278 | FGF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428552 | FGF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428587 | FGF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428588 | FGF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400278 | Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 |
USD 436.00 |
|
| LY428552 | Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 4 |
USD 436.00 |
|
| LY428587 | Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 5 |
USD 436.00 |
|
| LY428588 | Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 6 |
USD 436.00 |
|
| PH307434 | FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_000791) |
USD 2,055.00 |
|
| PH327317 | FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138364) |
USD 2,055.00 |
|
| PH327790 | FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138406) |
USD 2,055.00 |
|
| PH327797 | FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138407) |
USD 2,055.00 |
|
| TP307434 | Recombinant protein of human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 |
USD 823.00 |
|
| TP327317 | Purified recombinant protein of Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 4 |
USD 748.00 |
|
| TP327790 | Purified recombinant protein of Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 5 |
USD 748.00 |
|
| TP327797 | Purified recombinant protein of Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 6 |
USD 748.00 |
|
| TP720040 | Recombinant protein of human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 |
USD 330.00 |
|
| TP721185 | Purified recombinant protein of Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 |
USD 330.00 |
|
| TP750001 | Recombinant protein of human Fibroblast Growth Factor-acidic (FGF1) produced in E. coli |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China