FZR1 (NM_016263) Human Recombinant Protein
CAT#: TP301413
Recombinant protein of human fizzy/cell division cycle 20 related 1 (Drosophila) (FZR1), transcript variant 2
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201413 protein sequence
Red=Cloning site Green=Tags(s) MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKS PSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEKKGLFTYSLSTKRSSPD DGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVY LWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWN AEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQ YTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGY SQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKESVSVLNLFT RIR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Predicted MW | 54.6 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057347 |
| Locus ID | 51343 |
| UniProt ID | Q9UM11 |
| Cytogenetics | 19p13.3 |
| Refseq Size | 3615 |
| Refseq ORF | 1479 |
| Synonyms | CDC20C; CDH1; FZR; FZR2; HCDH; HCDH1 |
| Summary | Substrate-specific adapter for the anaphase promoting complex/cyclosome (APC/C) E3 ubiquitin-protein ligase complex. Associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis. Acts as an adapter for APC/C to target the DNA-end resection factor RBBP8/CtIP for ubiquitination and subsequent proteasomal degradation. Through the regulation of RBBP8/CtIP protein turnover, may play a role in DNA damage response, favoring DNA double-strand repair through error-prone non-homologous end joining (NHEJ) over error-free, RBBP8-mediated homologous recombination (HR) (PubMed:25349192).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
| Protein Pathways | Cell cycle, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402526 | FZR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC427845 | FZR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC427846 | FZR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY402526 | Transient overexpression lysate of fizzy/cell division cycle 20 related 1 (Drosophila) (FZR1), transcript variant 2 |
USD 436.00 |
|
| LY427845 | Transient overexpression lysate of fizzy/cell division cycle 20 related 1 (Drosophila) (FZR1), transcript variant 3 |
USD 436.00 |
|
| LY427846 | Transient overexpression lysate of fizzy/cell division cycle 20 related 1 (Drosophila) (FZR1), transcript variant 1 |
USD 436.00 |
|
| PH301413 | FZR1 MS Standard C13 and N15-labeled recombinant protein (NP_057347) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China