RRAGB (NM_006064) Human Recombinant Protein
CAT#: TP301860
Recombinant protein of human Ras-related GTP binding B (RRAGB), transcript variant RAGBs
View other "RRAGB" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201860 protein sequence
Red=Cloning site Green=Tags(s) MEESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTR RLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQ SCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIV YQLIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQFKLSCSKLAA SFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKQCLLMR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006055 |
Locus ID | 10325 |
UniProt ID | Q5VZM2, Q5VZM2-2 |
Cytogenetics | Xp11.21 |
Refseq Size | 2143 |
Refseq ORF | 1038 |
Synonyms | bA465E19.1; RAGB |
Summary | Ras-homologous GTPases constitute a large family of signal transducers that alternate between an activated, GTP-binding state and an inactivated, GDP-binding state. These proteins represent cellular switches that are operated by GTP-exchange factors and factors that stimulate their intrinsic GTPase activity. All GTPases of the Ras superfamily have in common the presence of six conserved motifs involved in GTP/GDP binding, three of which are phosphate-/magnesium-binding sites (PM1-PM3) and three of which are guanine nucleotide-binding sites (G1-G3). Transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413855 | RRAGB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC416897 | RRAGB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429513 | RRAGB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY413855 | Transient overexpression lysate of Ras-related GTP binding B (RRAGB), transcript variant RAGBl |
USD 396.00 |
|
LY416897 | Transient overexpression lysate of Ras-related GTP binding B (RRAGB), transcript variant RAGBs |
USD 396.00 |
|
LY429513 | Transient overexpression lysate of Ras-related GTP binding B (RRAGB), transcript variant RAGBl |
USD 396.00 |
|
PH301860 | RRAGB MS Standard C13 and N15-labeled recombinant protein (NP_006055) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review