HMGN3 (NM_138730) Human Recombinant Protein

CAT#: TP302339

Recombinant protein of human high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 2

Product Images

Coomassie blue staining of purified HMGN3 protein (Cat# TP302339). The protein was produced from HEK293T cells transfected with HMGN3 cDNA clone (Cat# RC202339) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202339 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEA
  GKEGTEN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_620058
• Locus ID: 9324
• UniProt ID: Q15651
• Cytogenetics: 6q14.1
• Refseq Size: 894
• Refseq ORF: 231
• Synonyms: PNAS-24; PNAS-25; TRIP7
• Summary: The protein encoded by this gene binds thyroid hormone receptor beta in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is a related pseudogene on chromosome 1. [provided by RefSeq, Jan 2016]
• Protein Families: Druggable Genome