HSPC142 (BABAM1) (NM_014173) Human Recombinant Protein
CAT#: TP302644
Recombinant protein of human chromosome 19 open reading frame 62 (C19orf62), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202644 protein sequence
Red=Cloning site Green=Tags(s) MEVAEPSSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGP KSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNALNVSQKMIEMFVRTKHKIDK SHEFALVVVNDDTAWLSGLTSDPRELCSCLYDLETASCSTFNLEGLFSLIQQKTELPVTENVQTIPPPYV VRTILVYSRPPCQPQFSLTEPMKKMFQCPYFFFDVVYIHNGTEEKEEEMSWKDMFAFMGSLDTKGTSYKY EVALAGPALELHNCMAKLLAHPLQRPCQSHASYSLLEEEDEAIEVEATV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_054892 |
Locus ID | 29086 |
UniProt ID | Q9NWV8, A0A024R7L2 |
Cytogenetics | 19p13.11 |
Refseq Size | 1467 |
Refseq ORF | 987 |
Synonyms | C19orf62; HSPC142; MERIT40; NBA1 |
Summary | Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. In the BRCA1-A complex, it is required for the complex integrity and its localization at DSBs. Component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin in various substrates (PubMed:24075985, PubMed:26195665). In these 2 complexes, it is probably required to maintain the stability of BABAM2 and help the 'Lys-63'-linked deubiquitinase activity mediated by BRCC3/BRCC36 component. The BRISC complex is required for normal mitotic spindle assembly and microtubule attachment to kinetochores via its role in deubiquitinating NUMA1 (PubMed:26195665). Plays a role in interferon signaling via its role in the deubiquitination of the interferon receptor IFNAR1; deubiquitination increases IFNAR1 activity by enhancing its stability and cell surface expression (PubMed:24075985). Down-regulates the response to bacterial lipopolysaccharide (LPS) via its role in IFNAR1 deubiquitination (PubMed:24075985).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415463 | BABAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422382 | BABAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415463 | Transient overexpression lysate of chromosome 19 open reading frame 62 (C19orf62), transcript variant 2 |
USD 396.00 |
|
LY422382 | Transient overexpression lysate of chromosome 19 open reading frame 62 (C19orf62), transcript variant 1 |
USD 396.00 |
|
PH302644 | C19orf62 MS Standard C13 and N15-labeled recombinant protein (NP_054892) |
USD 2,055.00 |
|
PH310626 | C19orf62 MS Standard C13 and N15-labeled recombinant protein (NP_001028721) |
USD 2,055.00 |
|
TP310626 | Recombinant protein of human chromosome 19 open reading frame 62 (C19orf62), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review