RANTES (CCL5) (NM_002985) Human Recombinant Protein

CAT#: TP303799

Recombinant protein of human chemokine (C-C motif) ligand 5 (CCL5)

Product Images

Human galectin-3 does not bind glycosylated CCL5, and lactose, a sugar known to inhibit glycan/galectin-3 binding, has no effect. CCL5 (OriGene TP303799) was incubated with different ratios of galectin-3-coated beads in the presence or absence of 100 mM lactose, and a bioplex assay measured CCL5 O-glycosylation in the supernatant. Figure cited from Nat Commun, PMID: 28986561

• 

  Coomassie blue staining of purified CCL5 protein (Cat# TP303799). The protein was produced from HEK293T cells transfected with CCL5 cDNA clone (Cat# RC203799) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203799 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNR
  QVCANPEKKWVREYINSLEMS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 7.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Binding assay (PMID: 28986561)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002976
• Locus ID: 6352
• UniProt ID: P13501, D0EI67
• Cytogenetics: 17q12
• Refseq Size: 1237
• Refseq ORF: 273
• Synonyms: D17S136E; eoCP; RANTES; SCYA5; SIS-delta; SISd; TCP228
• Summary: This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Epithelial cell signaling in Helicobacter pylori infection, NOD-like receptor signaling pathway, Prion diseases, Toll-like receptor signaling pathway