RANTES (CCL5) (NM_002985) Human Recombinant Protein
CAT#: TP723373
Purified recombinant protein of Human chemokine (C-C motif) ligand 5 (CCL5).
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
|
| Tag | Tag Free |
| Predicted MW | 7.8 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | Determined by its ability to chemoattract human blood monocytes using a concentration range of 1.0-10.0 ng/ml. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_002976 |
| Locus ID | 6352 |
| UniProt ID | P13501, D0EI67 |
| Cytogenetics | 17q12 |
| Refseq Size | 1237 |
| Refseq ORF | 273 |
| Synonyms | D17S136E; eoCP; RANTES; SCYA5; SIS-delta; SISd; TCP228 |
| Summary | 'This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]' |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Epithelial cell signaling in Helicobacter pylori infection, NOD-like receptor signaling pathway, Prion diseases, Toll-like receptor signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401044 | CCL5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401044 | Transient overexpression lysate of chemokine (C-C motif) ligand 5 (CCL5) |
USD 436.00 |
|
| PH303799 | CCL5 MS Standard C13 and N15-labeled recombinant protein (NP_002976) |
USD 2,055.00 |
|
| TP303799 | Recombinant protein of human chemokine (C-C motif) ligand 5 (CCL5) |
USD 823.00 |
|
| TP720050 | Recombinant protein of human chemokine (C-C motif) ligand 5 (CCL5) |
USD 330.00 |
|
| TP723778 | Purified recombinant protein of Human chemokine (C-C motif) ligand 5 (CCL5 / RANTES) |
USD 205.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China