COMT (NM_007310) Human Recombinant Protein
CAT#: TP304127
Recombinant protein of human catechol-O-methyltransferase (COMT), transcript variant 4
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204127 representing NM_007310
Red=Cloning site Green=Tags(s) MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCG YSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFL DHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKA IYKGPGSEAGP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009294 |
Locus ID | 1312 |
UniProt ID | P21964 |
Cytogenetics | 22q11.21 |
Refseq Size | 2035 |
Refseq ORF | 663 |
Synonyms | HEL-S-98n |
Summary | Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. [provided by RefSeq, Sep 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Metabolic pathways, Tyrosine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400254 | COMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400254 | Transient overexpression lysate of catechol-O-methyltransferase (COMT), transcript variant 1 |
USD 325.00 |
|
PH301275 | COMT MS Standard C13 and N15-labeled recombinant protein (NP_000745) |
USD 2,055.00 |
|
PH304127 | COMT MS Standard C13 and N15-labeled recombinant protein (NP_009294) |
USD 2,055.00 |
|
TP301275 | Purified recombinant protein of Homo sapiens catechol-O-methyltransferase (COMT), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review