Germany
Japan
United Kingdom
China
SGK3 (NM_013257) Human Recombinant Protein
CAT#: TP304416
Recombinant protein of human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1
Product Images
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204416 protein sequence
Red=Cloning site Green=Tags(s) MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMAL KIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKL HSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAE RNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSI KIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAV LYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFE SLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPP SEDLFL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 56.9 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_037389 |
| Locus ID | 23678 |
| UniProt ID | Q96BR1, A0A024R807, Q53EW6, Q5H9Q5 |
| Cytogenetics | 8q13.1 |
| Refseq Size | 4206 |
| Refseq ORF | 1488 |
| Synonyms | CISK; SGK2; SGKL |
| Summary | This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406888 | SGK3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
| LC415716 | SGK3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
| LC422403 | SGK3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
| LY406888 | Transient overexpression lysate of serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 2 |
USD 495.00 |
|
| LY415716 | Transient overexpression lysate of serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1 |
USD 325.00 |
|
| LY422403 | Transient overexpression lysate of serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3 |
USD 495.00 |
|
| PH304416 | SGK3 MS Standard C13 and N15-labeled recombinant protein (NP_037389) |
USD 2,055.00 |
|
| TP760266 | Recombinant protein of human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
