CDK2AP1 (NM_004642) Human Recombinant Protein
CAT#: TP304442
Recombinant protein of human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204442 protein sequence
Red=Cloning site Green=Tags(s) MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAII EELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 12.2 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004633 |
| Locus ID | 8099 |
| UniProt ID | O14519 |
| Cytogenetics | 12q24.31 |
| Refseq Size | 1655 |
| Refseq ORF | 345 |
| Synonyms | doc-1; DOC1; DORC1; p12DOC-1; ST19 |
| Summary | The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggests a regulatory role in DNA replication during the S-phase of the cell cycle. This protein also forms a core subunit of the nucleosome remodeling and histone deacetylation (NURD) complex that epigenetically regulates embryonic stem cell differentiation. This gene thus plays a role in both cell-cycle and epigenetic regulation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2012] |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401472 | CDK2AP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401472 | Transient overexpression lysate of cyclin-dependent kinase 2 associated protein 1 (CDK2AP1) |
USD 436.00 |
|
| PH304442 | CDK2AP1 MS Standard C13 and N15-labeled recombinant protein (NP_004633) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China