CHMP4C (NM_152284) Human Recombinant Protein

CAT#: TP304802

Recombinant protein of human chromatin modifying protein 4C (CHMP4C)

Product Images

Coomassie blue staining of purified CHMP4C protein (Cat# TP304802). The protein was produced from HEK293T cells transfected with CHMP4C cDNA clone (Cat# RC204802) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204802 representing NM_152284
  Red=Cloning site Green=Tags(s)
  
  MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALK
  RKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQD
  IAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRS
  RAASSQRAEEEDDDIKQLAAWAT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_689497
• Locus ID: 92421
• UniProt ID: Q96CF2
• Cytogenetics: 8q21.13
• Refseq Size: 1847
• Refseq ORF: 699
• Synonyms: Shax3; SNF7-3; VPS32C
• Summary: CHMP4C belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008]
• Protein Pathways: Endocytosis