CHMP4C (NM_152284) Human Recombinant Protein
CAT#: TP304802
Recombinant protein of human chromatin modifying protein 4C (CHMP4C)
View other "CHMP4C" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204802 representing NM_152284
Red=Cloning site Green=Tags(s) MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALK RKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQD IAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRS RAASSQRAEEEDDDIKQLAAWAT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689497 |
Locus ID | 92421 |
UniProt ID | Q96CF2 |
Cytogenetics | 8q21.13 |
Refseq Size | 1847 |
Refseq ORF | 699 |
Synonyms | Shax3; SNF7-3; VPS32C |
Summary | CHMP4C belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008] |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407666 | CHMP4C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407666 | Transient overexpression lysate of chromatin modifying protein 4C (CHMP4C) |
USD 396.00 |
|
PH304802 | CHMP4C MS Standard C13 and N15-labeled recombinant protein (NP_689497) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review