SLIRP (NM_031210) Human Recombinant Protein
CAT#: TP305002
Recombinant protein of human chromosome 14 open reading frame 156 (C14orf156)
View other "SLIRP" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205002 protein sequence
Red=Cloning site Green=Tags(s) MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSE EGLRNALQQENHIIDGVKVQVHTRRPKLPQTSDDEKKDF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_112487 |
Locus ID | 81892 |
UniProt ID | Q9GZT3 |
Cytogenetics | 14q24.3 |
Refseq Size | 420 |
Refseq ORF | 327 |
Synonyms | C14orf156; DC50; PD04872 |
Summary | Steroid receptor RNA activator (SRA, or SRA1; MIM 603819) is a complex RNA molecule containing multiple stable stem-loop structures that functions in coactivation of nuclear receptors. SLIRP interacts with stem-loop structure-7 of SRA (STR7) and modulates nuclear receptor transactivation (Hatchell et al., 2006 [PubMed 16762838]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410590 | SLIRP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410590 | Transient overexpression lysate of chromosome 14 open reading frame 156 (C14orf156) |
USD 396.00 |
|
PH305002 | C14orf156 MS Standard C13 and N15-labeled recombinant protein (NP_112487) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review