SLIRP (NM_031210) Human Recombinant Protein

CAT#: TP305002

Recombinant protein of human chromosome 14 open reading frame 156 (C14orf156)

Product Images

Coomassie blue staining of purified SLIRP protein (Cat# TP305002). The protein was produced from HEK293T cells transfected with SLIRP cDNA clone (Cat# RC205002) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205002 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSE
  EGLRNALQQENHIIDGVKVQVHTRRPKLPQTSDDEKKDF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_112487
• Locus ID: 81892
• UniProt ID: Q9GZT3
• Cytogenetics: 14q24.3
• Refseq Size: 420
• Refseq ORF: 327
• Synonyms: C14orf156; DC50; PD04872
• Summary: Steroid receptor RNA activator (SRA, or SRA1; MIM 603819) is a complex RNA molecule containing multiple stable stem-loop structures that functions in coactivation of nuclear receptors. SLIRP interacts with stem-loop structure-7 of SRA (STR7) and modulates nuclear receptor transactivation (Hatchell et al., 2006 [PubMed 16762838]).[supplied by OMIM, Mar 2008]