UNC50 (NM_014044) Human Recombinant Protein

CAT#: TP305276

Purified recombinant protein of Homo sapiens unc-50 homolog (C. elegans) (UNC50)

Product Images

Coomassie blue staining of purified UNC50 protein (Cat# TP305276). The protein was produced from HEK293T cells transfected with UNC50 cDNA clone (Cat# RC205276) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205276 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYR
  KQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKY
  LVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTF
  LGYSALPFLKNTVILLYPFAPLILLYGLSLALGWNFTHTLCSFYKYRVK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 30.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_054763
• Locus ID: 25972
• UniProt ID: Q53HI1, A0A0S2Z612
• Cytogenetics: 2q11.2
• Refseq Size: 1167
• Refseq ORF: 777
• Synonyms: GMH1; HSD23; PDLs22; UNCL; URP
• Summary: May be involved in cell surface expression of neuronal nicotinic receptors. Binds RNA (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane