CGGBP1 (NM_003663) Human Recombinant Protein

CAT#: TP308653

Recombinant protein of human CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 2

Product Images

Coomassie blue staining of purified CGGBP1 protein (Cat# TP308653). The protein was produced from HEK293T cells transfected with CGGBP1 cDNA clone (Cat# RC208653) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208653 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKR
  KAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSI
  PKSDQLRRAYLPDGYENENQLLNSQDC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003654
• Locus ID: 8545
• UniProt ID: Q9UFW8
• Cytogenetics: 3p11.1
• Refseq Size: 4506
• Refseq ORF: 501
• Synonyms: CGGBP; p20-CGGBP
• Summary: This gene encodes a CGG repeat-binding protein that primarily localizes to the nucleus. CGG trinucleotide repeats are implicated in many disorders as they often act as transcription- and translation-regulatory elements, can produce hairpin structures which cause DNA replication errors, and form regions prone to chromosomal breakage. CGG repeats are also targets for CpG methylation. In addition to its ability to bind CGG repeats and regulate transcription, this gene is believed to play a role in DNA damage repair and telomere protection. In vitro studies indicate this protein does not bind to methylated CpG sequences. [provided by RefSeq, Jul 2017]