CGGBP1 (NM_001008390) Human Mass Spec Standard

CAT#: PH323883

CGGBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001008391)

Product Images

Coomassie blue staining of purified CGGBP1 protein (Cat# TP323883). The protein was produced from HEK293T cells transfected with CGGBP1 cDNA clone (Cat# RC223883) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223883
• Predicted MW: 18.8 kDa
• Protein Sequence:
  Sequence Link

  >RC223883 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKR
  KAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSI
  PKSDQLRRAYLPDGYENENQLLNSQDC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001008391
• RefSeq Size: 4608
• RefSeq ORF: 501
• Synonyms: CGGBP; p20-CGGBP
• Locus ID: 8545
• UniProt ID: Q9UFW8
• Cytogenetics: 3p11.1
• Summary: This gene encodes a CGG repeat-binding protein that primarily localizes to the nucleus. CGG trinucleotide repeats are implicated in many disorders as they often act as transcription- and translation-regulatory elements, can produce hairpin structures which cause DNA replication errors, and form regions prone to chromosomal breakage. CGG repeats are also targets for CpG methylation. In addition to its ability to bind CGG repeats and regulate transcription, this gene is believed to play a role in DNA damage repair and telomere protection. In vitro studies indicate this protein does not bind to methylated CpG sequences. [provided by RefSeq, Jul 2017]