PCBD2 (NM_032151) Human Recombinant Protein

CAT#: TP308859

Recombinant protein of human pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 (PCBD2)

Product Images

Coomassie blue staining of purified PCBD2 protein (Cat# TP308859). The protein was produced from HEK293T cells transfected with PCBD2 cDNA clone (Cat# RC208859) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208859 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNF
  NQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_115527
• Locus ID: 84105
• UniProt ID: Q9H0N5
• Cytogenetics: 5q31.1
• Refseq Size: 2395
• Refseq ORF: 390
• Synonyms: DCOH2; DCOHM; PHS2
• Summary: Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2 (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transcription Factors