PCBD2 (NM_032151) Human Recombinant Protein
CAT#: TP308859
Recombinant protein of human pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 (PCBD2)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208859 protein sequence
Red=Cloning site Green=Tags(s) MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNF NQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115527 |
Locus ID | 84105 |
UniProt ID | Q9H0N5 |
Cytogenetics | 5q31.1 |
Refseq Size | 2395 |
Refseq ORF | 390 |
Synonyms | DCOH2; DCOHM; PHS2 |
Summary | Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2 (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403146 | PCBD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403146 | Transient overexpression lysate of pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 (PCBD2) |
USD 396.00 |
|
PH308859 | PCBD2 MS Standard C13 and N15-labeled recombinant protein (NP_115527) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review