KREMEN1 (NM_001039571) Human Recombinant Protein

CAT#: TP308991

Recombinant protein of human kringle containing transmembrane protein 1 (KREMEN1), transcript variant 4

Product Images

Coomassie blue staining of purified KREMEN1 protein (Cat# TP308991). The protein was produced from HEK293T cells transfected with KREMEN1 cDNA clone (Cat# RC208991) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208991 representing NM_001039571
  Red=Cloning site Green=Tags(s)
  
  MAPPAARLALLSAAALTLAARPAPSPGLGPGPECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNT
  LKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKT
  SNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFD
  TLVGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRV
  LARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSV
  SAARSSKVLYVITTSPSHPPQTVPGWTVYGLATLLILTVTAIVAKILLHVTFKSHRVPASGDLRDCHQPG
  TSGEIWSIFYKPSTSISIFKKKLKGQSQQDDRNPLVSD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 48.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001034660
• Locus ID: 83999
• UniProt ID: Q96MU8
• Cytogenetics: 22q12.1
• Refseq Size: 6115
• Refseq ORF: 1374
• Synonyms: FLJ31863; KREMEM1; KREMEN; kringle-coding gene marking the eye and the nose; kringle-containing transmembrane protein 1; kringle containing transmembrane protein 1; KRM1; OTTHUMP00000028977
• Summary: This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane