Interferon gamma (IFNG) (NM_000619) Human Recombinant Protein

CAT#: TP309993

Purified recombinant protein of Homo sapiens interferon, gamma (IFNG), 20 µg

Product Images

Coomassie blue staining of purified IFNG protein (Cat# TP309993). The protein was produced from HEK293T cells transfected with IFNG cDNA clone (Cat# RC209993) using MegaTran 2.0 (Cat# TT210002).

• 

  Recombinant Hu IFNG protein (TP309993) 100ng/mL was coated on plate and incubated at 4°C for overnight. After blocking with 1%BSA, 2x serially diluted primary antibody TA805799 (0.78 to 50ng/mL) and 5000x diluted HRP conjugated goat anti-mouse IgG were used for detection. Signal/Background ratio=19.5, EC50=10.27 ng/ml

• 

  Recombinant Hu IFNG protein (TP309993) 100ng/mL was coated on plate and incubated at 4°C for overnight. After blocking with 1%BSA, 2x serially diluted primary antibody TA805798 (0.78 to 50ng/mL) and 5000x diluted HRP conjugated goat anti-mouse IgG were used for detection. Signal/Background ratio=14.3, EC50=35.11 ng/ml

Specifications

Product Data

• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209993 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQS
  QIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVM
  AELSPAAKTGKRKRSQMLFRGRRASQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000610
• Locus ID: 3458
• UniProt ID: P01579
• Cytogenetics: 12q15
• Refseq Size: 1240
• Refseq ORF: 498
• Synonyms: IFG; IFI; IMD69
• Summary: This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Dec 2015]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Allograft rejection, Cytokine-cytokine receptor interaction, Graft-versus-host disease, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Proteasome, Regulation of autophagy, Systemic lupus erythematosus, T cell receptor signaling pathway, TGF-beta signaling pathway, Type I diabetes mellitus