Interferon gamma (IFNG) (NM_000619) Human Recombinant Protein

CAT#: TP721239

Purified recombinant protein of Human interferon, gamma (IFNG)

Product Images

Promyelocytic leukemia (PML) colocalized with endogenous tripartite motif-containing protein 22 (TRIM22) in Hep-2 cells treated with IFN-gamma. Hep-2 cells were incubated with IFN-gamma (OriGene TP721239) (150 U/ml) or with the vehicle for 48 hours and analyzed by immunofluorescence with anti-TRIM22 mouse monoclonal antibody and anti-PML rabbit polyclonal antibody. Insets show enlarged views of the areas indicated by the white squares. DIC is the differential interference contrast image. Figure cited from Front Immunol, PMID: 28555140

Specifications

Product Data

• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
• Tag: Tag Free
• Predicted MW: 16.8 kDa
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.0
• Bioactivity: Cell treatment (PMID: 28555140)
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000610
• Locus ID: 3458
• UniProt ID: P01579
• Cytogenetics: 12q15
• Refseq Size: 1240
• Refseq ORF: 498
• Synonyms: IFG; IFI; IMD69
• Summary: 'This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Dec 2015]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Allograft rejection, Cytokine-cytokine receptor interaction, Graft-versus-host disease, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Proteasome, Regulation of autophagy, Systemic lupus erythematosus, T cell receptor signaling pathway, TGF-beta signaling pathway, Type I diabetes mellitus