Interferon gamma (IFNG) (NM_000619) Human Recombinant Protein
CAT#: TP721239
Purified recombinant protein of Human interferon, gamma (IFNG)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
|
Tag | Tag Free |
Predicted MW | 16.8 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.0 |
Bioactivity | Cell treatment (PMID: 28555140) |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000610 |
Locus ID | 3458 |
UniProt ID | P01579 |
Cytogenetics | 12q15 |
Refseq Size | 1240 |
Refseq ORF | 498 |
Synonyms | IFG; IFI; IMD69 |
Summary | 'This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Dec 2015]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Allograft rejection, Cytokine-cytokine receptor interaction, Graft-versus-host disease, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Proteasome, Regulation of autophagy, Systemic lupus erythematosus, T cell receptor signaling pathway, TGF-beta signaling pathway, Type I diabetes mellitus |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400207 | IFNG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400207 | Transient overexpression lysate of interferon, gamma (IFNG) |
USD 325.00 |
|
PH309993 | IFNG MS Standard C13 and N15-labeled recombinant protein (NP_000610) |
USD 2,055.00 |
|
TP309993 | Purified recombinant protein of Homo sapiens interferon, gamma (IFNG) |
USD 823.00 |
|
TP720013 | Recombinant protein of human interferon, gamma (IFNG) |
USD 300.00 |
|
TP723162 | Purified recombinant protein of Human interferon, gamma (IFNG). |
USD 140.00 |
|
TP723709 | Purified recombinant protein of Human interferon, gamma (IFNG) |
USD 145.00 |
|
TP760490 | Purified recombinant protein of Human interferon, gamma (IFNG), with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review