ACOT12 (NM_130767) Human Recombinant Protein

CAT#: TP310445

Recombinant protein of human acyl-CoA thioesterase 12 (ACOT12)

Product Images

Coomassie blue staining of purified ACOT12 protein (Cat# TP310445). The protein was produced from HEK293T cells transfected with ACOT12 cDNA clone (Cat# RC210445) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210445 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERPAPGEVVMSQAIQPAHATARGELSAGQLLKWIDTTACLAAEKHAGVSCVTASVDDIQFEETARVGQV
  ITIKAKVTRAFSTSMEISIKVMVQDMLTGIEKLVSVAFSTFVAKPVGKEKIHLKPVTLLTEQDHVEHNLA
  AERRKVRLQHEDTFNNLMKESSKFDDLIFDEEEGAVSTRGTSVQSIELVLPPHANHHGNTFGGQIMAWME
  TVATISASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRVEAFDCQEWAEGRGRH
  INSAFLIYNAADDKENLITFPRIQPISKDDFRRYRGAIARKRIRLGRKYVISHKEEVPLCIHWDISKQAS
  LSDSNVEALKKLAAKRGWEVTSTVEKIKIYTLEEHDVLSVWVEKHVGSPAHLAYRLLSDFTKRPLWDPHF
  VSCEVIDWVSEDDQLYHITCPILNDDKPKDLVVLVSRRKPLKDGNTYTVAVKSVILPSVPPSPQYIRSEI
  ICAGFLIHAIDSNSCIVSYFNHMSASILPYFAGNLGGWSKSIEETAASCIQFLENPPDDGFVSTF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 61.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_570123
• Locus ID: 134526
• UniProt ID: Q8WYK0
• Cytogenetics: 5q14.1
• Refseq Size: 1989
• Refseq ORF: 1665
• Synonyms: Cach; CACH-1; STARD15; THEAL
• Summary: Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH (PubMed:16951743). Acyl-coenzyme A thioesterase 12/ACOT12 preferentially hydrolyzes acetyl-CoA (PubMed:16951743).[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Pyruvate metabolism